PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0521s0030.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family ARF
Protein Properties Length: 1136aa    MW: 127204 Da    PI: 6.5398
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0521s0030.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3733.5e-23123224199
                             EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEE CS
                      B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvv 81 
                             f+k+lt sd++++g +++p++ ae++      +++++  ++l+ +d++ +sW++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+
  SapurV1A.0521s0030.2.p 123 FCKTLTASDTSTHGGFSVPRRAAEKIfppldfSMQPPA-QELVARDLHDNSWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVL 208
                             99*****************************9445444.38********************************************** PP

                             EEE-SSSEE..EEEEE-S CS
                      B3  82 Fkldgrsefelvvkvfrk 99 
                             F   ++++ +l+++++r+
  SapurV1A.0521s0030.2.p 209 FI--RDEKSQLLLGIRRA 224
                             **..45677789999997 PP

2Auxin_resp123.31.7e-40249331183
              Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                             aahaa+++s+F+++YnPras+seFv++++k++ka++++vs+GmRf+m+fete+s  rr++Gt++g+sd+d+vrW+nS+Wr+L+
  SapurV1A.0521s0030.2.p 249 AAHAAANNSPFTIFYNPRASPSEFVIPFSKYNKAMYTQVSLGMRFRMMFETEESGVRRYMGTITGISDMDQVRWKNSQWRNLQ 331
                             79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.44E-44113252IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.6E-42115238IPR015300DNA-binding pseudobarrel domain
CDDcd100175.50E-20122223No hitNo description
PfamPF023622.4E-21123224IPR003340B3 DNA binding domain
SMARTSM010192.7E-24123225IPR003340B3 DNA binding domain
PROSITE profilePS5086312.407123225IPR003340B3 DNA binding domain
PfamPF065077.8E-36249331IPR010525Auxin response factor
PfamPF023093.0E-99741063IPR033389AUX/IAA domain
PROSITE profilePS5174523.89771070IPR000270PB1 domain
SuperFamilySSF542772.55E-79921055No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0010311Biological Processlateral root formation
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 1136 aa     Download sequence    Send to blast
MKVPSNGFLP NFAEGERKCI NSELWHACAG PLVSLPPVGS LVVYFPQGHS EQVAASMQKE  60
TDFIPSYPNL PSKLICMLHN VTLHADVETD EVYAQMTLQP YEKEALIASD MGLKQNRQPT  120
EFFCKTLTAS DTSTHGGFSV PRRAAEKIFP PLDFSMQPPA QELVARDLHD NSWTFRHIYR  180
GQPKRHLLTT GWSVFVSTKR LFAGDSVLFI RDEKSQLLLG IRRANRQQPA LSSSVISSDS  240
MHIGILAAAA HAAANNSPFT IFYNPRASPS EFVIPFSKYN KAMYTQVSLG MRFRMMFETE  300
ESGVRRYMGT ITGISDMDQV RWKNSQWRNL QVGWDESTAG ERPSRVSIWE IEPVVTPFYI  360
YPPPFFRPKF PKQPGMPDDE SDIENAFKRA MPWLGDEFGM KDPPSSIFPG LSLVQWMSMQ  420
QNNQFPAAQS GFFPSMVPSN ALHNNLGTDD PSKLLNFQAP GLSPPSVQFN KTNPQNQVGQ  480
LPQPPMAWTQ QQQLQQLLQN PIPQHQQQPP YPQQQQQPPY PQQQQQQHWP QQQPQQQQTR  540
QPPPQIQQHQ QQQQIFQPPT LNERAVSPNQ IPNQNLQHPV LYSHLQQQQQ QQQHLLASNT  600
QSQSIPSANK SSYQLTSFPQ DSQLHQQMEQ QSNLSQRKQQ QTQSQPSPLL LLQQNLSQRP  660
QPQQQQSQPS HSEQQLHLQL LQKLQQQQQQ QQLPSPASSV LQSQQLQQQQ THQQHQQLQQ  720
SPLSQNQQPH GSNSFSTAAI MRTQSFPMNQ PQGLQKPPMA VRAHSNITDG EAPSCSTSPS  780
TNNCQISPPN FLNRNQLAPA MLIGDSAIEP AGNIIQDLQS KSDIHVKNEF PSSRGLDQLK  840
YKGVVTDQLE ASSSGTSYCL DAGNIQQNFS VPAFGLDGDV QSHPRNSLPF ASSIDALEPD  900
ILLSREYDSQ KDLQNLLANY GGTARDIETE LSTAAISSQS FGVPNIPLKP GCSNDVAIND  960
TGVMNNGLWT NQTQRMRTYT KVQKRGSVGR SIDVTRYKGY NELRHDLARM FGIEGQLEDP  1020
QSSDWKLVYV DHENDILLVG EDPWEEFVSC VQNIKILSSA EVQQMSLDGD LGSRAPATDV  1080
VLGARAVDFP SAIIPQILAP LLQLLPSDGG FPHITTTSSS TLDYIRQRGQ EAKDP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1701535245388Auxin response factor 5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003609970.10.0auxin response factor 2
TrEMBLG7JS690.0G7JS69_MEDTR; Auxin response factor
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19